Menu CATEGORIES

Connect with us

CATEGORIES Menu
All Articles

Achieve Eternal Glory—Audition for the Varsity Show

For the 118th time in Columbia’s illustrious history, the Varsity Show is holding auditions for singers, dancers, actors, and generally talented students to participate in (you guessed it), the Varsity Show! This oldest of Columbia performing arts traditions has featured many famous alums in its day, including Rodgers and Hammerstein and more recently, Jenny Slate (the voice behind Marcel the Shell). So if you want to be a part of history, this is your chance!

Would-be theatrical superstars are advised to head over to Hamilton Hall tonight, Wednesday, or Thursday night from 8 to 11 pm prepared with 16 bars of a musical theater song. Sides will be provided.

Click to show comments
6 Comments

Write a comment

Your email address will not be published.

 

6 Comments

  • alum says:

    @alum Is there an archive or some public domain where we can watch old Varsity shows. I must admit in my four years at CU I definitely did not attend any of the shows >.< I only remember a preview for prefrosh I attended as a freshy.

    It would be nice to see some of the old productions, since they pretty much capture the culture and the major events of the year XD

    1. VShow alum says:

      @VShow alum There are DVDs via the website, though only going back to 110 (109 is on DVD as well, but there are too few copies to sell). They’re $20 each. You can also listen to the cast recordings as well and download them for free.

      Also the Library has a copy of the final book for all 117 shows.

      http://www.thevarsityshow.com/

    2. VShow alum says:

      @VShow alum The website sells DVDs from 110 on upwards (V109 is on DVD but there are only like 2 copies left/used for reference by Creative). You can however listen to the cast recordings and download them for free.

      The Library also has a copy of every final book for each year.

  • CC11' says:

    @CC11' famous alums in its day, including Rodgers and Hammerstein and more recently, Jenny Slate (the voice behind Marcel the Shell).

    Never heard of them.

    1. Anonymous says:

      @Anonymous you’re an idiot.

  • Anonymous says:

    @Anonymous isn’t it always freshmen who don’t know any better?

  • Ad

    Have Your Say

    What should Bwog's new tagline be?

    View Results

    Loading ... Loading ...

    Recent Comments

    AGJFFNNFHVIDVMVOYOUUUUYYYYYYGOGOGINNHYG TGOTOOIOGGJHHKINNHJ AssoppSM DDDDDDDMDMCMSAAASSSCMMFVVNMMMMCMCCKMFRMRMRYOUOUOUUOUYYJJFFFJFFFJFFFFJFJFJFFFFFJFFJFFYYJGGJWWFFGVUFVUFVBHFDJBFFFUJVRUBNFUV JUGJFI BGBGFBFGBFBFFFHHFHFHFHFHFHFHFHGHRHRHBVDJSSJUOYOYOYIUUJNNNNMM,O,MOKMMIOTHHDHFRIFoiytjghnf (read more)
    Butler Archetypes: Dicking Around
    October 26, 2020
    ILL TRY BUT IF THIS DOSENT WORK IM GOING TO BLOCK THIS WEBSITE (read more)
    How To Impress Your Class Crush On Zoom
    October 26, 2020
    Ok so i'm 11 and i'm on my nintendo and i'm really into this boy and i'm see if this (read more)
    How To Impress Your Class Crush On Zoom
    October 25, 2020
    this will go good but not having no pants on is to much but he's gonna love me after (read more)
    How To Impress Your Class Crush On Zoom
    October 25, 2020

    Comment Policy

    The purpose of Bwog’s comment section is to facilitate honest and open discussion between members of the Columbia community. We encourage commenters to take advantage of—without abusing—the opportunity to engage in anonymous critical dialogue with other community members. A comment may be moderated if it contains:
    • A slur—defined as a pejorative derogatory phrase—based on ethnicity, race, gender, sexual orientation, ability, or spiritual belief
    • Hate speech
    • Unauthorized use of a person’s identity
    • Personal information about an individual
    • Baseless personal attacks on specific individuals
    • Spam or self-promotion
    • Copyright infringement
    • Libel
    • COVID-19 misinformation