Menu CATEGORIES

Connect with us

CATEGORIES Menu
Posts Tagged with "november 2010"
All Articles

Magazine Preview: Campus Gossip

The November issue of The Blue and White will be here soon. Read selections from the magazine on Bwog. Say Cheese An adult, leading a group of what looks like young high school students onto Revson Plaza, points at statue of Bellerophon Taming Pegasus: “That’s modern art…” Points at the statue of the Tightrope Walker […]

Read More
All Articles

Magazine Preview: There’s an App for That!

The November issue of The Blue and White will be here shortly.  Until then, enjoy selections from the issue on Bwog! Tiresias2T-Pain Recite Lit Hum’s lines and receive T-Pain’s rhymes (feat. Mista Ramsay & Shorty Sancho). Ballin’. Pothole Protection Maps protruding and raised obstructions on College Walk, including but not limited to: cracks, loose stones, divots, kids, […]

Read More
All Articles

Magazine Preview: The Broadway Bomb

The November issue of The Blue and White will be on campus shortly.  Bwog has posted highlights from the issue over the last few weeks–take a look! “You could die,” reads the slogan of the Broadway Bomb, an unsanctioned longboard race down the legendary avenue. The disclaimer is no exaggeration; more than 500 boarders barreled […]

Read More
All Articles

Magazine Preview: Take the 6 to Pelham Bay

The latest issue of The Blue and White hits campus very soon.  You can read the entire magazine on Bwog until then. In this installment of End of the Line, Claire Sabel visits the Bronx riviera. The 6 train emerges from beneath East 139th street, rising in languid arcs above the Bronx. It crosses over […]

Read More
All Articles

Magazine Preview: Kia Walton, Campus Character

The November issue of The Blue & White will be arriving on campus soon. In the mean time, we’ll be trickling out the issue on Bwog. You might not know the following figure—but you should. In Campus Characters, The Blue & White introduces you to a handful of Columbians who are up to interesting and […]

Read More
All Articles

Magazine Preview: Our Super Sad True Columbia Story

We’ll let you know when the November issue of The Blue and White arrives in buildings on campus, but until then, enjoy the entire issue as we preview it on Bwog. In an nontraditional marketing move, author and Columbia professor Gary Shteyngart attempted to attract a different set of readers to his summer release, Super […]

Read More
All Articles

Magazine Preview: Man About Town

The November issue of The Blue and White will be arriving on campus momentarily.  Meanwhile, enjoy selections from the current edition on Bwog. At first it seemed innocuous enough: a couscous-like, gluten-free, and protein-rich alternative to rice. What damage could it possibly cause? Formerly confined to the lower shelves of Whole Foods and other “informed” […]

Read More
All Articles

Magazine Preview: The 106th Street Castle

The newest issue of The Blue and White will soon arrive.  Until then, enjoy the magazine in its entirety as we preview it on Bwog. Morningside old timers remember “the castle” at 106th and Central Park West as it once was. Not an inch of the restored structure betrays its past today, but for 40 […]

Read More
All Articles

Magazine Preview: Can You Get Away With It?

The November issue of The Blue and White will be here soon and we’ll be posting all the articles on Bwog.  “At Two Swords’ Length” is a feature presenting opposing opinions on an issue. This month, Brian Donahoe and Sam Schube discuss whether you can get away with it. Affirmative I’ve been doing it for […]

Read More
All Articles

Magazine Preview: Welcome to the Club

It's not necessarily true that being a varsity sports team is more rewarding.

Read More
All Articles

Magazine Preview: Rat Rock

Catch up on the November issue of The Blue and White on Bwog until the print edition arrives. Always an area of intense pressure and continental clashes, Morningside Heights was pretty much the same place 450 million years ago as it is today. Except instead of panic attacks in Butler and anti-protest protests on College […]

Read More
All Articles

Magazine Preview: It’s Miller Time

Until the print edition arrives, read the November issue of The Blue and White on Bwog. Today, Sam Schube catches up with the director of Columbia’s Miller Theatre. Miller Theatre, although regarded as a premier forum for contemporary dance and music, has struggled to carry its citywide renown into its own backyard. Despite Miller’s on-campus […]

Read More
All Articles

Magazine Preview: The Conservator

"I looked down and I saw the Velasquez and Rubens and Del Sarto and I thought, 'You know, life isn't so bad.'"

Read More
All Articles

Magazine Preview: From Butler to the Ballot

A board game, illustrated by Cindy Pan, from the November issue of The Blue and White! Try out your luck as a Columbia politician. (image opens in pop up)

Read More
All Articles

Magazine Preview: Speaking in Tongues

This is not just languages. Columbia is a very decentralized place in general.

Read More
Ad

Have Your Say

What should Bwog's new tagline be?

View Results

Loading ... Loading ...

Recent Comments

AGJFFNNFHVIDVMVOYOUUUUYYYYYYGOGOGINNHYG TGOTOOIOGGJHHKINNHJ AssoppSM DDDDDDDMDMCMSAAASSSCMMFVVNMMMMCMCCKMFRMRMRYOUOUOUUOUYYJJFFFJFFFJFFFFJFJFJFFFFFJFFJFFYYJGGJWWFFGVUFVUFVBHFDJBFFFUJVRUBNFUV JUGJFI BGBGFBFGBFBFFFHHFHFHFHFHFHFHFHGHRHRHBVDJSSJUOYOYOYIUUJNNNNMM,O,MOKMMIOTHHDHFRIFoiytjghnf (read more)
Butler Archetypes: Dicking Around
October 26, 2020
ILL TRY BUT IF THIS DOSENT WORK IM GOING TO BLOCK THIS WEBSITE (read more)
How To Impress Your Class Crush On Zoom
October 26, 2020
Ok so i'm 11 and i'm on my nintendo and i'm really into this boy and i'm see if this (read more)
How To Impress Your Class Crush On Zoom
October 25, 2020
this will go good but not having no pants on is to much but he's gonna love me after (read more)
How To Impress Your Class Crush On Zoom
October 25, 2020

Comment Policy

The purpose of Bwog’s comment section is to facilitate honest and open discussion between members of the Columbia community. We encourage commenters to take advantage of—without abusing—the opportunity to engage in anonymous critical dialogue with other community members. A comment may be moderated if it contains:
  • A slur—defined as a pejorative derogatory phrase—based on ethnicity, race, gender, sexual orientation, ability, or spiritual belief
  • Hate speech
  • Unauthorized use of a person’s identity
  • Personal information about an individual
  • Baseless personal attacks on specific individuals
  • Spam or self-promotion
  • Copyright infringement
  • Libel
  • COVID-19 misinformation