Menu CATEGORIES

Connect with us

CATEGORIES Menu
Posts Tagged with "strippers"
All Articles

Bwoglines: New Beginnings Edition

It’s finally time to buy an apartment in Manhattan! (NY Mag) MTV is letting people like you choose where to send season 2 of Jersey Shore. Giants Stadium is being demolished. (Daily News) Strippers (including an NYU student) pick the Saints to win the Super Bowl. (Post)

Read More
All Articles

QuickSpec – And they’re off!

Hm, you heard this anywhere before? Barnard Students get authentic New York experience STRIPPERS STRIPPERS STRIPPERS (gotcha) Three hours before this becomes part of someone’s platform. Anti-War professor speaks at anti-war rally because he is anti-war. Stop the War!

Read More
All Articles

QuickSpec

Domain expansion plan emimminent, waiting for eminent domain Homeless wish they were paid $75 to act homeless The Green Monster? Strippers? In case you’re wondering which Republican to vote for… “I Don’t  See Any Snakes In This  Eden”

Read More
Ad

Have Your Say

What should Bwog's new tagline be?

View Results

Loading ... Loading ...

Recent Comments

AGJFFNNFHVIDVMVOYOUUUUYYYYYYGOGOGINNHYG TGOTOOIOGGJHHKINNHJ AssoppSM DDDDDDDMDMCMSAAASSSCMMFVVNMMMMCMCCKMFRMRMRYOUOUOUUOUYYJJFFFJFFFJFFFFJFJFJFFFFFJFFJFFYYJGGJWWFFGVUFVUFVBHFDJBFFFUJVRUBNFUV JUGJFI BGBGFBFGBFBFFFHHFHFHFHFHFHFHFHGHRHRHBVDJSSJUOYOYOYIUUJNNNNMM,O,MOKMMIOTHHDHFRIFoiytjghnf (read more)
Butler Archetypes: Dicking Around
October 26, 2020
ILL TRY BUT IF THIS DOSENT WORK IM GOING TO BLOCK THIS WEBSITE (read more)
How To Impress Your Class Crush On Zoom
October 26, 2020
Ok so i'm 11 and i'm on my nintendo and i'm really into this boy and i'm see if this (read more)
How To Impress Your Class Crush On Zoom
October 25, 2020
this will go good but not having no pants on is to much but he's gonna love me after (read more)
How To Impress Your Class Crush On Zoom
October 25, 2020

Comment Policy

The purpose of Bwog’s comment section is to facilitate honest and open discussion between members of the Columbia community. We encourage commenters to take advantage of—without abusing—the opportunity to engage in anonymous critical dialogue with other community members. A comment may be moderated if it contains:
  • A slur—defined as a pejorative derogatory phrase—based on ethnicity, race, gender, sexual orientation, ability, or spiritual belief
  • Hate speech
  • Unauthorized use of a person’s identity
  • Personal information about an individual
  • Baseless personal attacks on specific individuals
  • Spam or self-promotion
  • Copyright infringement
  • Libel
  • COVID-19 misinformation