Menu CATEGORIES

Connect with us

CATEGORIES Menu
Posts Tagged with "west harlem"
All Articles

Hey, Jerome!

Columbia’s controversial Manhattanville campus is open for business! Bwog headed (a little farther) uptown to check out the newest Jerome Greene Science Center. Columbia is finally moving into its new home in Manhattanville this week, with the opening of the Jerome Greene Science Center. The building is the first of about six to establish Columbia’s […]

Read More
All Articles

From The Mag: Self-Service

For our last offering from our dearest Mother Magazine, The Blue and White, we present Senior Editor Channing Prend’s, CC ’17, look into Columbia’s Community Scholars Program. Like any other student, Eric Washington has a CUID, logs in using his UNI, and takes courses at Columbia. Yet he’s not enrolled in any of the university’s 20 […]

Read More
All Articles

Manhattanville Goes To NY Court of Appeals

This is kinda-sorta-maybe-it! As you may recall, December brought a major obstacle to Columbia’s dreams of expansion: the New York State Supreme Court decided 3-2 that that state could not use eminent domain to secure parts of West Harlem for Manhattanville. The Empire State Development Corporation, the only major defendant in December’s case, has appealed […]

Read More
Ad

Have Your Say

What should Bwog's new tagline be?

View Results

Loading ... Loading ...

Recent Comments

AGJFFNNFHVIDVMVOYOUUUUYYYYYYGOGOGINNHYG TGOTOOIOGGJHHKINNHJ AssoppSM DDDDDDDMDMCMSAAASSSCMMFVVNMMMMCMCCKMFRMRMRYOUOUOUUOUYYJJFFFJFFFJFFFFJFJFJFFFFFJFFJFFYYJGGJWWFFGVUFVUFVBHFDJBFFFUJVRUBNFUV JUGJFI BGBGFBFGBFBFFFHHFHFHFHFHFHFHFHGHRHRHBVDJSSJUOYOYOYIUUJNNNNMM,O,MOKMMIOTHHDHFRIFoiytjghnf (read more)
Butler Archetypes: Dicking Around
October 26, 2020
ILL TRY BUT IF THIS DOSENT WORK IM GOING TO BLOCK THIS WEBSITE (read more)
How To Impress Your Class Crush On Zoom
October 26, 2020
Ok so i'm 11 and i'm on my nintendo and i'm really into this boy and i'm see if this (read more)
How To Impress Your Class Crush On Zoom
October 25, 2020
this will go good but not having no pants on is to much but he's gonna love me after (read more)
How To Impress Your Class Crush On Zoom
October 25, 2020

Comment Policy

The purpose of Bwog’s comment section is to facilitate honest and open discussion between members of the Columbia community. We encourage commenters to take advantage of—without abusing—the opportunity to engage in anonymous critical dialogue with other community members. A comment may be moderated if it contains:
  • A slur—defined as a pejorative derogatory phrase—based on ethnicity, race, gender, sexual orientation, ability, or spiritual belief
  • Hate speech
  • Unauthorized use of a person’s identity
  • Personal information about an individual
  • Baseless personal attacks on specific individuals
  • Spam or self-promotion
  • Copyright infringement
  • Libel
  • COVID-19 misinformation