Menu CATEGORIES

Connect with us

CATEGORIES Menu
Posts Tagged with "summer bwoglines"
All Articles

Neighborhood News

With this flurry of news about Bacchanal and Columbia’s new Gender-Based Misconduct Policy, you may have missed some recent updates to our community. Not going to lie, they’re not as exciting. Haakon’s Hall, that weird bar you’ve probably never been to, is becoming a gluten-free, farm-to-table restaurant called Friedman’s Lunch. (Crains New York) But maybe […]

Read More
All Articles

Bwoglines: Early June Edition

Are you enjoying your summer job? A Columbia student is working as mermaid-stripper called Naiad at an undercover strip club in New York. (NYT) A U.S. Army Captain stationed in Afghanistan made a surprise appearance at his daughter’s class day. Make sure you grab a Kleenex before you watch. (NY Daily News) Morton B. Friedman, […]

Read More
All Articles

Stuff That Happened In August

Some Columbia related news passed in the month of August.  We rounded it up for you: Aditya Mukerjee, CC ’12 and the former publisher of Spec, was detained at the airport after setting off an alarm because he had bedbug spray residue on his hands. “You’ve got to understand, when someone of your background, traveling […]

Read More
All Articles

Summer Update, Part II

As you take refuge from the sweltering midsummer heat (or cold, if you’re super abroad) amidst frozen margaritas with friends or popsicles on a couch you haven’t left in three days, the world somehow manages to continue turning. Keep reading to find out in which direction.   Remember when J.P. Morgan lost more than $2 […]

Read More
Ad

Have Your Say

What should Bwog's new tagline be?

View Results

Loading ... Loading ...

Recent Comments

Couldn't have said it better myself. Remember... they're always watching. (read more)
Pigeons And Roaches And Rats, Oh My!
October 26, 2020
AGJFFNNFHVIDVMVOYOUUUUYYYYYYGOGOGINNHYG TGOTOOIOGGJHHKINNHJ AssoppSM DDDDDDDMDMCMSAAASSSCMMFVVNMMMMCMCCKMFRMRMRYOUOUOUUOUYYJJFFFJFFFJFFFFJFJFJFFFFFJFFJFFYYJGGJWWFFGVUFVUFVBHFDJBFFFUJVRUBNFUV JUGJFI BGBGFBFGBFBFFFHHFHFHFHFHFHFHFHGHRHRHBVDJSSJUOYOYOYIUUJNNNNMM,O,MOKMMIOTHHDHFRIFoiytjghnf (read more)
Butler Archetypes: Dicking Around
October 26, 2020
ILL TRY BUT IF THIS DOSENT WORK IM GOING TO BLOCK THIS WEBSITE (read more)
How To Impress Your Class Crush On Zoom
October 26, 2020

Comment Policy

The purpose of Bwog’s comment section is to facilitate honest and open discussion between members of the Columbia community. We encourage commenters to take advantage of—without abusing—the opportunity to engage in anonymous critical dialogue with other community members. A comment may be moderated if it contains:
  • A slur—defined as a pejorative derogatory phrase—based on ethnicity, race, gender, sexual orientation, ability, or spiritual belief
  • Hate speech
  • Unauthorized use of a person’s identity
  • Personal information about an individual
  • Baseless personal attacks on specific individuals
  • Spam or self-promotion
  • Copyright infringement
  • Libel
  • COVID-19 misinformation